TA333994 SLC25A11 antibody

Rabbit Polyclonal Anti-SLC25A11 Antibody

See related secondary antibodies

Search for all "SLC25A11"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish SLC25A11

Product Description for SLC25A11

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish SLC25A11.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SLC25A11

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Mitochondrial 2-oxoglutarate/malate carrier protein, OGCP, SLC20A4, Solute carrier family 25 member 11
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Sh, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q02978
Immunogen:
The immunogen for Anti-SLC25A11 Antibody: synthetic peptide directed towards the C terminal of human SLC25A11. Synthetic peptide located within the following region: DGKPEYKNGLDVLFKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFLEQM.
GeneID:
8402
Application WB
Background SLC25A11 catalyzes the transport of 2-oxoglutarate across the inner mitochondrial membrane in an electroneutral exchange for malate or other dicarboxylic acids, and plays an important role in several metabolic processes, including the malate-aspartate shuttle, the oxoglutarate/isocitrate shuttle, in gluconeogenesis from lactate, and in nitrogen metabolism.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SLC25A11 (5 products)

Catalog No. Species Pres. Purity   Source  

SLC25A11

SLC25A11 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

SLC25A11

SLC25A11 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

SLC25A11

SLC25A11 Human Purified
  Abnova Taiwan Corp.

SLC25A11

SLC25A11 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

SLC25A11

SLC25A11 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for SLC25A11 (1 products)

Catalog No. Species Pres. Purity   Source  

SLC25A11 Lysate

Western Blot: SLC25A11 Lysate [NBL1-16047] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for SLC25A11
  Novus Biologicals Inc.
  • LinkedIn