TA334005 ZIC3 antibody

Rabbit Polyclonal Anti-ZIC3 Antibody

See related secondary antibodies

Search for all "ZIC3"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat ZIC3

Product Description for ZIC3

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat ZIC3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZIC3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Zinc finger protein ZIC 3, Zinc finger protein of the cerebellum 3
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O60481
Immunogen:
The immunogen for Anti-ZIC3 Antibody: synthetic peptide directed towards the N terminal of human ZIC3. Synthetic peptide located within the following region: HHHHHTSQVPSYGGAASAAFNSTREFLFRQRSSGLSEAASGGGQHGLFAG.
GeneID:
7547
Application WB
Background This gene encodes a member of the ZIC family of C2H2-type zinc finger proteins. This nuclear protein probably functions as a transcription factor in early stages of left-right body axis formation. Mutations in this gene cause X-linked visceral heterotaxy, which includes congenital heart disease and left-right axis defects in organs.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZIC3 (6 products)

Catalog No. Species Pres. Purity   Source  

ZIC3 (N-term HIS tag)

ZIC3 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

ZIC3

ZIC3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

ZIC3

ZIC3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

ZIC3

ZIC3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZIC3

ZIC3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZIC3

ZIC3 Human
  Abnova Taiwan Corp.

Positive controls for ZIC3 (1 products)

Catalog No. Species Pres. Purity   Source  

ZIC3 overexpression lysate

ZIC3 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn