TA334008 ZFP37 antibody

Rabbit Polyclonal Anti-ZFP37 Antibody

See related secondary antibodies

Search for all "ZFP37"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Rat ZFP37

Product Description for ZFP37

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Rat ZFP37.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZFP37

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Zfp-37, Zinc finger protein 37 homolog
Presentation Purified
Reactivity Bov, Can, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y6Q3
Immunogen:
The immunogen for Anti-ZFP37 Antibody: synthetic peptide directed towards the middle region of human ZFP37. Synthetic peptide located within the following region: LCCHSSSHIKQDKIQTGEKHEKSPSLSSSTKHEKPQACVKPYECNQCGKV.
GeneID:
7539
Application WB
Background ZFP37 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 12 C2H2-type zinc fingers and 1 KRAB domain. ZFP37 may be involved in transcriptiol regulation.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZFP37 (3 products)

Catalog No. Species Pres. Purity   Source  

ZFP37 (full length, N-term HIS tag)

ZFP37 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

ZFP37

ZFP37 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZFP37

ZFP37 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ZFP37 (3 products)

Catalog No. Species Pres. Purity   Source  

ZFP37 293T Cell Transient Overexpression Lysate(Denatured)

ZFP37 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ZFP37 Lysate

Western Blot: ZFP37 Lysate [NBL1-18020] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for ZFP37.
  Novus Biologicals Inc.

ZFP37 overexpression lysate

ZFP37 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn