TA334034 SP3 / SPR-2 antibody

Rabbit Polyclonal Anti-SP3 Antibody

See related secondary antibodies

Search for all "SP3 / SPR-2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat SP3 / SPR-2

TA334034

More Views

  • TA334034
  • TA334034

Product Description for SP3 / SPR-2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat SP3 / SPR-2.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for SP3 / SPR-2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Transcription factor Sp3
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q02447
Immunogen:
The immunogen for Anti-SP3 Antibody: synthetic peptide directed towards the middle region of human SP3. Synthetic peptide located within the following region: TAGINADGHLINTGQAMDSSDNSERTGERVSPDINETNTDTDLFVPTSSS.
GeneID:
6670
Application WB
IHC
Background SP3 is a transcriptiol factor that can act as an activator or repressor, probably in a isoform-specific manner. SP3 binds to GT and GC boxes promoters elements.This gene belongs to a family of Sp1 related genes that encode transcription factors that regulate transcription by binding to consensus GC- and GT-box regulatory elements in target genes. This protein contains a zinc finger D-binding domain and several transactivation domains, and has been reported to function as a bifunctiol transcription factor that either stimulates or represses the transcription of numerous genes. Transcript variants encoding different isoforms have been described for this gene, and one has been reported to initiate translation from a non-AUG (AUA) start codon. Additiol isoforms, resulting from the use of alterte downstream translation initiation sites, have also been noted.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SP3 / SPR-2 (6 products)

Catalog No. Species Pres. Purity   Source  

SP3 / SPR-2 (transcript variant 1)

SP3 / SPR-2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

SP3 / SPR-2

SP3 / SPR-2 Human
  Abnova Taiwan Corp.

SP3 / SPR-2

SP3 / SPR-2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

SP3 / SPR-2

SP3 / SPR-2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

SP3 / SPR-2

SP3 / SPR-2 Human
  Abnova Taiwan Corp.

SP3 / SPR-2

SP3 / SPR-2 Human
  Abnova Taiwan Corp.
  • LinkedIn