TA334111 Tensin-3 / TNS3 antibody

Rabbit Polyclonal Anti-Tns3 Antibody

See related secondary antibodies

Search for all "Tensin-3 / TNS3"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat Tensin-3 / TNS3

Product Description for Tensin-3 / TNS3

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat Tensin-3 / TNS3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Tensin-3 / TNS3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Tens1, Tensin-like SH2 domain-containing protein 1, Tns3
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5SSZ5
Immunogen:
The immunogen for Anti-Tns3 Antibody is: synthetic peptide directed towards the C-terminal region of MOUSE Tns3. Synthetic peptide located within the following region: FLTVSPGASSHHSPGLQNQNVSLPGQPPLPEKKRASEGDRSLGSVSPSSS.
GeneID:
319939
Application WB
Background Tns3 may play a role in actin remodeling. Involved in the dissociation of the integrin-tensin-actin complex. EGF activates TNS4 and down-regulates TNS3 which results in capping the tail of ITGB1. It seems to be involved in mammary cell migration. Tns3 may be involved in cell migration and bone development.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn