TA334133 FAM220A antibody

Rabbit Polyclonal Anti-FAM220A Antibody

See related secondary antibodies

Search for all "FAM220A"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human FAM220A

Product Description for FAM220A

Rabbit anti Human FAM220A.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FAM220A

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C7orf70, SIPAR, STAT3-interacting protein as a repressor
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q7Z4H9
Immunogen:
The immunogen for Anti-FAM220A Antibody is: synthetic peptide directed towards the middle region of Human FAM220A. Synthetic peptide located within the following region: ATPSTAVGLFPAPTECFARVSCSGVEALGRRDWLGGGPRATDGHRGQCPK.
GeneID:
84792
Application WB
Background FAM220A may negatively regulate STAT3.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for FAM220A (1 products)

Catalog No. Species Pres. Purity   Source  

FAM220A overexpression lysate

FAM220A overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn