TA334138 RPS16 antibody

Rabbit Polyclonal Anti-RPS16 Antibody

See related secondary antibodies

Search for all "RPS16"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish RPS16

Product Description for RPS16

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish RPS16.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RPS16

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 40S ribosomal protein S16
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P62249
Immunogen:
The immunogen for Anti-RPS16 Antibody: synthetic peptide directed towards the middle region of human RPS16. Synthetic peptide located within the following region: LVAYYQKYVDEASKKEIKDILIQYDRTLLVADPRRCKSKKFGGPGARAC.
GeneID:
6217
Application WB
Background Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 R species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S9P family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq, Jul 2008].
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for RPS16 (8 products)

Catalog No. Species Pres. Purity   Source  

RPS16 (full length, N-term HIS tag)

RPS16 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

RPS16 (1-146, His-tag)

RPS16 Human Purified > 90 % by SDS - PAGE E. coli
0.25 mg / €820.00
  OriGene Technologies GmbH

RPS16 (1-146, His-tag)

RPS16 Human Purified > 90 % by SDS - PAGE E. coli
50 µg / €320.00
  OriGene Technologies GmbH

RPS16

RPS16 Human in vitro transl.
  Abnova Taiwan Corp.

RPS16

RPS16 Human in vitro transl.
  Abnova Taiwan Corp.

RPS16

RPS16 Human in vitro transl.
  Abnova Taiwan Corp.

RPS16

RPS16 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

RPS16

RPS16 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for RPS16 (1 products)

Catalog No. Species Pres. Purity   Source  

RPS16 Lysate

Western Blot: RPS16 Lysate [NBL1-15562] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for RPS16
  Novus Biologicals Inc.
  • LinkedIn