TA334142 DPRX antibody

Rabbit Polyclonal Anti-DPRX Antibody

See related secondary antibodies

Search for all "DPRX"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human DPRX

Product Description for DPRX

Rabbit anti Human DPRX.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DPRX

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Divergent paired-related homeobox
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A6NFQ7
Immunogen:
The immunogen for Anti-DPRX Antibody is: synthetic peptide directed towards the N-terminal region of Human DPRX. Synthetic peptide located within the following region: KEMASKIDIHPTVLQVWFKNHRAKLKKAKCKHIHQKQETPQPPIPEGGVS.
GeneID:
503834
Application WB
Background Homeobox genes encode D-binding proteins, many of which are thought to be involved in early embryonic development. Homeobox genes encode a D-binding domain of 60 to 63 amino acids referred to as the homeodomain. This gene is a member of the DPRX homeobox gene family. Evidence of mR expression has not yet been found for this gene. Multiple, related processed pseudogenes have been found which are thought to reflect expression of this gene in the germ line or embryonic cells.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for DPRX (1 products)

Catalog No. Species Pres. Purity   Source  

DPRX overexpression lysate

DPRX overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn