TA334149 SLC41A3 antibody

Rabbit Polyclonal Anti-SLC41A3 Antibody

See related secondary antibodies

Search for all "SLC41A3"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish SLC41A3

Product Description for SLC41A3

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish SLC41A3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SLC41A3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Solute carrier family 41 member 3
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96GZ6
Immunogen:
The immunogen for Anti-SLC41A3 Antibody: synthetic peptide directed towards the C terminal of human SLC41A3. Synthetic peptide located within the following region: WHQALDPDNHCIPYLTGLGDLLGSSSVGHTAAVPRRCTASPGWGLIQPFI.
GeneID:
54946
Application WB
Background SLC41A3 is a multi-pass membrane protein. It belongs to the SLC41A transporter family. The exact function of SLC41A3 remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SLC41A3 (1 products)

Catalog No. Species Pres. Purity   Source  

SLC41A3 (transcript variant 1)

SLC41A3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for SLC41A3 (2 products)

Catalog No. Species Pres. Purity   Source  

SLC41A3 Lysate

Western Blot: SLC41A3 Lysate [NBL1-16156] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for SLC41A3.
  Novus Biologicals Inc.

SLC41A3 overexpression lysate

SLC41A3 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn