TA334153 Olfactory receptor 2AG1 antibody

Rabbit Polyclonal Anti-OR2AG1 Antibody

See related secondary antibodies

Search for all "Olfactory receptor 2AG1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat Olfactory receptor 2AG1

Product Description for Olfactory receptor 2AG1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat Olfactory receptor 2AG1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Olfactory receptor 2AG1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms HT3, OR2AG1, OR2AG3, Olfactory receptor OR11-79
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H205
Immunogen:
The immunogen for Anti-OR2AG1 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR2AG1. Synthetic peptide located within the following region: LAAILASYTQILLTVLHMPSNEGRKKALVTCSSHLTVVGMFYGAATFMYV.
GeneID:
144125
Application WB
Background Olfactory receptors interact with odorant molecules in the nose, to initiate a neurol response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant sigls. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Olfactory receptor 2AG1 (2 products)

Catalog No. Species Pres. Purity   Source  

Olfactory receptor 2AG1

Olfactory receptor 2AG1 Human Purified
  Abnova Taiwan Corp.

Olfactory receptor 2AG1

Olfactory receptor 2AG1 Human Purified
  Abnova Taiwan Corp.
  • LinkedIn