TA334195 Claudin-17 / CLDN17 antibody

Rabbit Polyclonal Anti-CLDN17 Antibody

See related secondary antibodies

Search for all "Claudin-17 / CLDN17"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Rat Claudin-17 / CLDN17

TA334195

More Views

  • TA334195
  • TA334195

Product Description for Claudin-17 / CLDN17

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Rat Claudin-17 / CLDN17.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for Claudin-17 / CLDN17

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms PRO1489, UNQ758
Presentation Aff - Purified
Reactivity Bov, Can, Hu, Ms, Por, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P56750
Immunogen:
The immunogen for anti-CLDN17 antibody: synthetic peptide directed towards the middle region of human CLDN17
AA Sequence:
KQVQCTGSNERAKAYLLGTSGVLFILTGIFVLIPVSWTANIIIRDFYNPA
GeneID:
26285
Application Western blotting (1 - 4 µg/ml)
Immunohistochemsitry on paraffin embedded sections (4 - 8 µg/ml)
Background CLDN17, clustered with CLDN8 at human chromosome 21q22.11, is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C. It plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.
General Readings Katoh,M. and Katoh,M. (2003) Int. J. Mol. Med. 11 (6), 683-689
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using Protein A affinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Mouse, Rat, Dog, Pig, Bovine
Species reactivity (tested):
Human

Accessory Products

Proteins and/or Positive Controls

Proteins for Claudin-17 / CLDN17 (2 products)

Catalog No. Species Pres. Purity   Source  

Claudin-17 / CLDN17

Claudin-17 / CLDN17 Human Purified
  Abnova Taiwan Corp.

Claudin-17 / CLDN17

Claudin-17 / CLDN17 Human Purified
  Abnova Taiwan Corp.

Positive controls for Claudin-17 / CLDN17 (2 products)

Catalog No. Species Pres. Purity   Source  

Claudin 17 Lysate

Western Blot: Claudin 17 Lysate [NBL1-09242] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for CLDN17.
  Novus Biologicals Inc.

CLDN17 overexpression lysate

CLDN17 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn