TA334202 Claudin-5 / CLDN5 antibody

Rabbit Polyclonal Anti-CLDN5 Antibody

See related secondary antibodies

Search for all "Claudin-5 / CLDN5"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat Claudin-5 / CLDN5

Product Description for Claudin-5 / CLDN5

Rabbit anti Bovine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat Claudin-5 / CLDN5.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Claudin-5 / CLDN5

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms AWAL, Bec1, Brain endothelial cell clone 1 protein, Lung-specific membrane protein, TMDVCF, TMVCF, Transmembrane protein deleted in VCFS
Presentation Purified
Reactivity Bov, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O00501
Immunogen:
The immunogen for anti-CLDN5 antibody: synthetic peptide directed towards the C terminal of human CLDN5. Synthetic peptide located within the following region: GWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATGDYDKKN.
GeneID:
7122
Application WB
Background CLDN5 is a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets. Mutations in this gene have been found in patients with velocardiofacial syndrome.This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets. Mutations in this gene have been found in patients with velocardiofacial syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Claudin-5 / CLDN5 (4 products)

Catalog No. Species Pres. Purity   Source  

Claudin-5 / CLDN5

Claudin-5 / CLDN5 Human Purified
  Abnova Taiwan Corp.

Claudin-5 / CLDN5

Claudin-5 / CLDN5 Human Purified
  Abnova Taiwan Corp.

Claudin-5 / CLDN5

Claudin-5 / CLDN5 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Claudin-5 / CLDN5

Claudin-5 / CLDN5 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Claudin-5 / CLDN5 (1 products)

Catalog No. Species Pres. Purity   Source  

Claudin 5 Lysate

Western Blot: Claudin 5 Lysate [NBL1-09247] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for CLDN5
  Novus Biologicals Inc.
  • LinkedIn