TA334203 Claudin-11 / CLDN11 antibody

Rabbit Polyclonal Anti-CLDN11 Antibody

See related secondary antibodies

Search for all "Claudin-11 / CLDN11"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Porcine, Rabbit Claudin-11 / CLDN11

TA334203

More Views

  • TA334203

Product Description for Claudin-11 / CLDN11

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Porcine, Rabbit Claudin-11 / CLDN11.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for Claudin-11 / CLDN11

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms OSP, OTM, Oligodendrocyte-specific protein
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Por, Rb
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O75508
Immunogen:
The immunogen for anti-CLDN11 antibody: synthetic peptide directed towards the C terminal of human CLDN11. Synthetic peptide located within the following region: VSFGYSLYAGWIGAVLCLVGGCVILCCAGDAQAFGENRFYYTAGSSSPTH.
GeneID:
5010
Application WB
IHC
Background CLDN11 belongs to the claudin family of tight junction associated proteins and is a major component of central nervous system myelin that is necessary for normal CNS function. There is growing evidence that the protein determines the permeability between layers of myelin sheaths via focal adhesion and, with its expression highly regulated during development, may play an important role in cellular proliferation and migration. In addition, the protein is a candidate autoantigen in the development of autoimmune demyeliting disease.The protein encoded by this gene belongs to the claudin family of tight junction associated proteins and is a major component of central nervous system myelin that is necessary for normal CNS function. There is growing evidence that the protein determines the permeability between layers of myelin sheaths via focal adhesion and, with its expression highly regulated during development, may play an important role in cellular proliferation and migration. In addition, the protein is a candidate autoantigen in the development of autoimmune demyeliting disease.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Claudin-11 / CLDN11 (4 products)

Catalog No. Species Pres. Purity   Source  

Claudin-11 / CLDN11

Claudin-11 / CLDN11 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Claudin-11 / CLDN11

Claudin-11 / CLDN11 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Claudin-11 / CLDN11

Claudin-11 / CLDN11 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Claudin-11 / CLDN11

Claudin-11 / CLDN11 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn