TA334210 LHX3 antibody

Rabbit Polyclonal Anti-LHX3 Antibody

See related secondary antibodies

Search for all "LHX3"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Chicken, Human, Mouse, Porcine, African clawed frog LHX3

TA334210

More Views

  • TA334210
  • TA334210

Product Description for LHX3

Rabbit anti Bovine, Canine, Chicken, Human, Mouse, Porcine, African clawed frog LHX3.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for LHX3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms LHX3, LIM homeobox protein 3, LIM/homeobox protein Lhx3
Presentation Aff - Purified
Reactivity African clawed frog, Bov, Can, Chk, Hu, Ms, Por
Applications P, WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UBR4
Immunogen:
The immunogen for anti-LHX3 antibody: synthetic peptide directed towards the middle region of human LHX3
AA Sequence:
QNRRAKEKRLKKDAGRQRWGQYFRNMKRSRGGSKSDKDSVQEGQDSDAEV
GeneID:
8022
Application Western blotting (1 - 3 µg/ml)
Immunohistochemsitry on paraffin embedded sections (4 - 8 µg/ml)
Background LHX3 encodes a member a large protein family which carry the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein is a transcription factor that is required for pituitary development and motor neuron specification. Mutations in this gene have been associated with a syndrome of combined pituitary hormone deficiency and rigid cervical spine.
General Readings Dattani,M.T. et al., (2003) Endocrinol Metab 16 (9), 1207-1209
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using Protein A affinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Mouse, Pig, Bovine, Dog, African clawed frog, Chicken
Species reactivity (tested):
Human

Accessory Products

Proteins and/or Positive Controls

Proteins for LHX3 (2 products)

Catalog No. Species Pres. Purity   Source  

LHX3

LHX3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

LHX3

LHX3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for LHX3 (1 products)

Catalog No. Species Pres. Purity   Source  

LHX3 Lysate

Western Blot: LHX3 Lysate [NBL1-12515] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for LHX3
  Novus Biologicals Inc.
  • LinkedIn