TA334217 NR1D2 antibody

Rabbit Polyclonal Anti-NR1D2 Antibody

See related secondary antibodies

Search for all "NR1D2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Rabbit, Rat, Zebrafish NR1D2

Product Description for NR1D2

Rabbit anti Bovine, Canine, Equine, Human, Rabbit, Rat, Zebrafish NR1D2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for NR1D2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms EAR-1R, Nuclear receptor subfamily 1 group D member 2, Orphan nuclear hormone receptor BD73, Rev-erb-beta
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q14995
Immunogen:
The immunogen for anti-NR1D2 antibody: synthetic peptide directed towards the middle region of human NR1D2. Synthetic peptide located within the following region: MSLFTAVVLVSADRSGIENVNSVEALQETLIRALRTLIMKNHPNEASIFT.
GeneID:
9975
Application WB
Background NR1D2 is a member of the nuclear hormone receptor family, specifically the NR1 subfamily of receptors. NR1D2 functions as a transcriptiol repressor and may play a role in circadian rhythms and carbohydrate and lipid metabolism. Altertively spliced transcript variants have been described.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for NR1D2 (3 products)

Catalog No. Species Pres. Purity   Source  

NR1D2 (transcript variant 1)

NR1D2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

NR1D2

NR1D2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

NR1D2

NR1D2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for NR1D2 (2 products)

Catalog No. Species Pres. Purity   Source  

NR1D2 293T Cell Transient Overexpression Lysate(Denatured)

NR1D2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

NR1D2 Lysate

Western Blot: NR1D2 Lysate [NBL1-13766] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for NR1D2
  Novus Biologicals Inc.
  • LinkedIn