TA334238 NFE2L3 antibody

Rabbit Polyclonal Anti-NFE2L3 Antibody

See related secondary antibodies

Search for all "NFE2L3"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Human, Mouse, Rat NFE2L3

Product Description for NFE2L3

Rabbit anti Bovine, Human, Mouse, Rat NFE2L3.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for NFE2L3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms NF-E2-related factor 3, NFE2-related factor 3, NRF3, Nuclear factor erythroid 2-related factor 3
Presentation Aff - Purified
Reactivity Bov, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Molecular weight 76 kDa (694 amino acids)
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y4A8
Immunogen:
Synthetic peptide directed towards the middle region of Human NFE2L3.
AA Sequence:
NPEQTLPGTNLTGFLSPVDNHMRNLTSQDLLYDLDINIFDEINLMSLATE
GeneID:
9603
Application Western blotting (0.2-1 µg/ml).
Background NFE2L3 belongs to the bZIP family, CNC subfamily, and activates erythroid-specific, globin gene expression. It forms heterodimers with MAFG, MAFK and other small MAF proteins that binds to the MAF recognition elements (MARE). NFE2L3 also called NRF3 is highly expressed in human placenta and also in B-cell and monocyte cell lines. Low expression is observed in heart, brain, lung, skeletal muscle, kidney and pancreas.
General Readings
  1. Kobayashi A, Ito E, Toki T, Kogame K, Takahashi S, Igarashi K, et al. Molecular cloning and functional characterization of a new Cap'n' collar family transcription factor Nrf3. J Biol Chem. 1999 Mar 5;274(10):6443-52. PubMed PMID: 10037736.
  2. Chénais B, Derjuga A, Massrieh W, Red-Horse K, Bellingard V, Fisher SJ, et al. Functional and placental expression analysis of the human NRF3 transcription factor. Mol Endocrinol. 2005 Jan;19(1):125-37. Epub 2004 Sep 23. PubMed PMID: 15388789.
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Peptide Immunoaffinity Chromatography
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Mouse (92%), Dog (92%), Bovine (85%), Rabbit (92%).
Species reactivity (tested):
Human.

Accessory Products

Proteins and/or Positive Controls

Proteins for NFE2L3 (4 products)

Catalog No. Species Pres. Purity   Source  

NFE2L3

NFE2L3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NFE2L3

NFE2L3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NFE2L3

NFE2L3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

NFE2L3

NFE2L3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn