Home » GTF2IRD1 / CREAM1

TA334243 GTF2IRD1 / CREAM1 antibody

Rabbit Polyclonal Anti-GTF2IRD1 Antibody

0.1 ml / €300.00

Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

View Datasheet

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Rabbit, Rat GTF2IRD1 / CREAM1

More Views

Product Description for GTF2IRD1 / CREAM1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Rabbit, Rat GTF2IRD1 / CREAM1.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for GTF2IRD1 / CREAM1

Product Category	Primary Antibodies
Quantity	0.1 ml
Synonyms	GTF2I repeat domain-containing protein 1, GTF2I repeat domain-containing protein 1, GTF3, General transcription factor II-I repeat domain-containing protein 1, General transcription factor III, MUSTRD1, MusTRD1/BEN, Muscle TFII-I repeat domain-containing protein 1, RBAP2, Slow-muscle-fiber enhancer-binding protein, USE B1-binding protein, WBSCR11, WBSCR12, Williams-Beuren syndrome chromosomal region 11 protein
Presentation	Purified
Reactivity	Bov, Can, Eq, GP, Hu, Rb, Rt
Applications	P, WB
Clonality	Polyclonal
Host	Rabbit
Isotype	IgG
Shipping to	Europe, USA/Canada
PDF datasheet	View Datasheet
Manufacturer	OriGene Technologies, Inc.

Datasheet Extract

Immunogen	Swiss Prot Num: Q9UHL9 Immunogen: The immunogen for anti-GTF2IRD1 antibody: synthetic peptide directed towards the C terminal of human GTF2IRD1. Synthetic peptide located within the following region: TFGSQNLERILAVADKIKFTVTRPFQGLIPKPDEDDANRLGEKVILREQV. GeneID: 9569
Application	WB IHC
Background	GTF2IRD1 contains five GTF2I-like repeats and each repeat possesses a potential helix-loop-helix (HLH) motif. It may have the ability to interact with other HLH-proteins and function as a transcription factor or as a positive transcriptiol regulator under the control of Retinoblastoma protein. GTF2IRD1 is related to Williams-Beuren syndrome, a multisystem developmental disorder. Western blots using three different antibodies against three unique regions of this protein target confirm the same apparent molecular weight in our tests. The protein encoded by this gene contains five GTF2I-like repeats and each repeat possesses a potential helix-loop-helix (HLH) motif. It may have the ability to interact with other HLH-proteins and function as a transcription factor or as a positive transcriptiol regulator under the control of Retinoblastoma protein. This gene is deleted in Williams-Beuren syndrome, a multisystem developmental disorder caused by deletion of multiple genes at 7q11.23. Altertive splicing of this gene generates at least 2 transcript variants.
Format	Purification: Protein A purified Buffer System: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. State: Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for GTF2IRD1 / CREAM1 (8 products)

Catalog No.	Species	Pres.	Purity	Source
TP302128	GTF2IRD1 / CREAM1 (transcript variant 1)
	Human		> 80 % Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps. Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.	HEK293 cells	20 µg / €788.00
					OriGene Technologies, Inc.
TP318834	GTF2IRD1 / CREAM1 (transcript variant 2)
	Human		> 80 % Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps. Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.	HEK293 cells	20 µg / €788.00
					OriGene Technologies, Inc.
H00009569-P01-10	GTF2IRD1 / CREAM1
	Human	Purified	12.5% SDS-PAGE Stained with Coomassie Blue.
					Abnova Taiwan Corp.
H00009569-P01-25	GTF2IRD1 / CREAM1
	Human	Purified	12.5% SDS-PAGE Stained with Coomassie Blue.
					Abnova Taiwan Corp.
H00009569-P02	GTF2IRD1 / CREAM1
	Human	Purified
					Abnova Taiwan Corp.
H00009569-P02-25	GTF2IRD1 / CREAM1
	Human	Purified
					Abnova Taiwan Corp.
H00009569-Q01-10	GTF2IRD1 / CREAM1
	Human		12.5% SDS-PAGE Stained with Coomassie Blue.	in vitro transl.
					Abnova Taiwan Corp.
H00009569-Q01-25	GTF2IRD1 / CREAM1
	Human		12.5% SDS-PAGE Stained with Coomassie Blue.	in vitro transl.
					Abnova Taiwan Corp.

Positive controls for GTF2IRD1 / CREAM1 (6 products)

Catalog No.	Species	Purity
H00009569-T01	GTF2IRD1 293T Cell Transient Overexpression Lysate(Denatured)

			Abnova Taiwan Corp.
L121T6	GTF2IRD1 HEK293 Cell Transient Overexpression Lysate (Non-Denatured)
		Transient overexpression cell lysate was tested with Anti-GTF2IRD1 antibody (H00009569-M01) by Western Blots.
			Abnova Taiwan Corp.
NBL1-11393	GTF2IRD1 Lysate

			Novus Biologicals Inc.
LY414061	GTF2IRD1 overexpression lysate
			0.1 mg / €295.00
			OriGene Technologies, Inc.
LY417136	GTF2IRD1 overexpression lysate
			0.1 mg / €495.00
			OriGene Technologies, Inc.
LY429262	GTF2IRD1 overexpression lysate
			0.1 mg / €495.00
			OriGene Technologies, Inc.

Recommended Secondary Antibodies for GTF2IRD1 / CREAM1 (9 products)

Catalog No.	Host	Pres.	React.	Applications
R1364AP	Rabbit IgG (H+L chain) antibody
	Goat	AP	Rb	E, WB
					OriGene Technologies GmbH
R1364B	Rabbit IgG (H+L chain) antibody
	Goat	Biotin	Rb	E, WB
					OriGene Technologies GmbH
R1364F	Rabbit IgG (H+L chain) antibody
	Goat	FITC	Rb	E, ICC/IF, WB
					OriGene Technologies GmbH
R1364HRP	Rabbit IgG (H+L chain) antibody
	Goat	HRP	Rb	E, P, WB
					OriGene Technologies GmbH
R1364T	Rabbit IgG (H+L chain) antibody
	Goat	TRITC	Rb	E, F, ICC/IF
					OriGene Technologies GmbH
R1427R	Rabbit IgG F(ab)2 Fragment (H+L chain) antibody
	Donkey	PE	Rb	F
					OriGene Technologies GmbH
R1458C2	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy2
					OriGene Technologies GmbH
R1458C3	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy3
					OriGene Technologies GmbH
R1458C5	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy5
					OriGene Technologies GmbH

Click here to see all secondary antibodies for GTF2IRD1 / CREAM1

Antibodies (see all»)

Kits (see all»)

Antigens

Lysates (see all»)

Tissue Slides (see all»)

Other life-science products