TA334247 TBX4 antibody

Rabbit Polyclonal Anti-Tbx4 Antibody

See related secondary antibodies

Search for all "TBX4"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat TBX4

Product Description for TBX4

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat TBX4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TBX4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms T-box protein 4, T-box transcription factor TBX4
Presentation Purified
Reactivity Bov, Can, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P57082
Immunogen:
The immunogen for Anti-Tbx4 antibody is: synthetic peptide directed towards the N-terminal region of Rat Tbx4. Synthetic peptide located within the following region: DKGLSESEEAFRAPGPALGETSNSNNTNVPEPALATPGLSGTALSSPPGQ.
GeneID:
9496
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn