TA334276 Afamin / AFM antibody

Rabbit Polyclonal Anti-AFM Antibody

See related secondary antibodies

Search for all "Afamin / AFM"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rabbit Afamin / AFM

Product Description for Afamin / AFM

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rabbit Afamin / AFM.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Afamin / AFM

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ALB2, ALBA, Alpha-albumin
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Por, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P43652
Immunogen:
The immunogen for anti-AFM antibody: synthetic peptide directed towards the C terminal of human AFM. Synthetic peptide located within the following region: HADMCQSQNEELQRKTDRFLVNLVKLKHELTDEELQSLFTNFANVVDKCC.
GeneID:
173
Application WB
Background AFM is a member of the albumin gene family, which is comprised of four genes that localize to chromosome 4 in a tandem arrangement. These four genes encode structurally-related serum transport proteins that are known to be evolutiorily related. AFM is regulated developmentally, expressed in the liver and secreted into the bloodstream.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Afamin / AFM (3 products)

Catalog No. Species Pres. Purity   Source  

Afamin / AFM

Afamin / AFM Human
  Abnova Taiwan Corp.

Afamin / AFM

Afamin / AFM Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Afamin / AFM

Afamin / AFM Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for Afamin / AFM (1 products)

Catalog No. Species Pres. Purity   Source  

AFM 293T Cell Transient Overexpression Lysate(Denatured)

AFM 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn