TA334295 SLC1A2 / EAAT2 antibody

Rabbit Polyclonal Anti-SLC1A2 Antibody

See related secondary antibodies

Search for all "SLC1A2 / EAAT2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat SLC1A2 / EAAT2

TA334295

More Views

  • TA334295

Product Description for SLC1A2 / EAAT2

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat SLC1A2 / EAAT2.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for SLC1A2 / EAAT2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Excitatory amino acid transporter 2, GLT1, Glutamate/aspartate transporter II, Sodium-dependent glutamate/aspartate transporter 2, Solute carrier family 1 member 2
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P43004
Immunogen:
The immunogen for anti-SLC1A2 antibody: synthetic peptide directed towards the middle region of human SLC1A2. Synthetic peptide located within the following region: LVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQHRVHEDIEM.
GeneID:
6506
Application WB
IHC
Background SLC1A2 is a member of a family of solute transporter proteins. The membrane-bound protein is the principal transporter that clears the excitatory neurotransmitter glutamate from the extracellular space at sypses in the central nervous system. Glutamate clearance is necessary for proper syptic activation and to prevent neurol damage from excessive activation of glutamate receptors. Mutations in and decreased expression of this protein are associated with amyotrophic lateral sclerosis. Altertively spliced transcript variants of this gene have been described, but their full-length ture is not known. This gene encodes a member of a family of solute transporter proteins. The membrane-bound protein is the principal transporter that clears the excitatory neurotransmitter glutamate from the extracellular space at sypses in the central nervous system. Glutamate clearance is necessary for proper syptic activation and to prevent neurol damage from excessive activation of glutamate receptors. Mutations in and decreased expression of this protein are associated with amyotrophic lateral sclerosis. Altertively spliced transcript variants of this gene have been described, but their full-length ture is not known. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SLC1A2 / EAAT2 (4 products)

Catalog No. Species Pres. Purity   Source  

SLC1A2 / EAAT2

SLC1A2 / EAAT2 Human Purified
  Abnova Taiwan Corp.

SLC1A2 / EAAT2

SLC1A2 / EAAT2 Human Purified
  Abnova Taiwan Corp.

SLC1A2 / EAAT2

SLC1A2 / EAAT2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

SLC1A2 / EAAT2

SLC1A2 / EAAT2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn