TA334298 PLP1 antibody

Rabbit Polyclonal Anti-PLP1 Antibody

See related secondary antibodies

Search for all "PLP1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Rabbit, Rat PLP1

Product Description for PLP1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Rabbit, Rat PLP1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PLP1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Lipophilin, Myelin proteolipid protein, PLP
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P60201
Immunogen:
The immunogen for anti-PLP1 antibody: synthetic peptide directed towards the middle region of human PLP1. Synthetic peptide located within the following region: IYGTASFFFLYGALLLAEGFYTTGAVRQIFGDYKTTICGKGLSATVTGGQ.
GeneID:
5354
Application WB
Background PLP1 is a transmembrane proteolipid protein that is the predomint myelin protein present in the central nervous system. It may play a role in the compaction, stabilization, and maintence of myelin sheaths, as well as in oligodendrocyte development and axol survival. Mutations in this gene cause X-linked Pelizaeus-Merzbacher disease and spastic paraplegia type 2.This gene encodes a transmembrane proteolipid protein that is the predomint myelin protein present in the central nervous system. It may play a role in the compaction, stabilization, and maintence of myelin sheaths, as well as in oligodendrocyte development and axol survival. Mutations in this gene cause X-linked Pelizaeus-Merzbacher disease and spastic paraplegia type 2. Altertively spliced transcript variants encoding distinct isoforms or having different 5' UTRs, have been identified for this gene.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PLP1 (3 products)

Catalog No. Species Pres. Purity   Source  

PLP1

PLP1 Human Purified Solid phase synthesis - HPLC: >80%
  OriGene Technologies GmbH

PLP1

PLP1 Human in vitro transl.
  Abnova Taiwan Corp.

PLP1

PLP1 Human in vitro transl.
  Abnova Taiwan Corp.

Positive controls for PLP1 (1 products)

Catalog No. Species Pres. Purity   Source  

Myelin PLP Lysate

Western Blot: Myelin PLP Lysate [NBL1-14523] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PLP1
  Novus Biologicals Inc.
  • LinkedIn