TA334309 Histone H2A.J / H2AFJ antibody

Rabbit Polyclonal Anti-H2AFJ Antibody

See related secondary antibodies

Search for all "Histone H2A.J / H2AFJ"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Mouse, Porcine, Rat, Zebrafish Histone H2A.J / H2AFJ

Product Description for Histone H2A.J / H2AFJ

Rabbit anti Bovine, Canine, Equine, Mouse, Porcine, Rat, Zebrafish Histone H2A.J / H2AFJ.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Histone H2A.J / H2AFJ

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Purified
Reactivity Bov, Can, Eq, Ms, Por, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BTM1
Immunogen:
The immunogen for anti-H2AFJ antibody is: synthetic peptide directed towards the N-terminal region of Human H2AFJ. Synthetic peptide located within the following region: AKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAE.
GeneID:
55766
Application WB
Background Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of D wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the D between the nucleosomes to form higher order chromatin structures. This gene is located on chromosome 12 and encodes a variant H2A histone. The protein is divergent at the C-terminus compared to the consensus H2A histone family member.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn