TA334315 KIF24 antibody

Rabbit Polyclonal Anti-KIF24 Antibody

See related secondary antibodies

Search for all "KIF24"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human KIF24

Product Description for KIF24

Rabbit anti Human KIF24.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for KIF24

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C9orf48, Kinesin-like protein KIF24
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5T7B8
Immunogen:
The immunogen for anti-KIF24 antibody is: synthetic peptide directed towards the C-terminal region of Human KIF24. Synthetic peptide located within the following region: SLAEKPYCSQVDFIYRQERGGGSSFDLRKDASQSEVSGENEGNLPSPEED.
GeneID:
347240
Application WB
Background Kinesins, such as KIF24, are microtubule-dependent ATPases that function as molecular motors. They play important roles in intracellular vesicle transport and cell division.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for KIF24 (1 products)

Catalog No. Species Pres. Purity   Source  

KIF24 overexpression lysate

KIF24 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn