TA334344 PARS2 antibody

Rabbit Polyclonal Anti-PARS2 Antibody

See related secondary antibodies

Search for all "PARS2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat PARS2

Product Description for PARS2

Rabbit anti Bovine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat PARS2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PARS2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ProRS, Probable prolyl-tRNA synthetase mitochondrial, Proline-tRNA ligase
Presentation Purified
Reactivity Bov, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q7L3T8
Immunogen:
The immunogen for anti-PARS2 antibody is: synthetic peptide directed towards the C-terminal region of Human PARS2. Synthetic peptide located within the following region: AIEVLSTEDCVRWPSLLAPYQACLIPPKKGSKEQAASELIGQLYDHITEA.
GeneID:
25973
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PARS2 (2 products)

Catalog No. Species Pres. Purity   Source  

PARS2

PARS2 Human Purified
  Abnova Taiwan Corp.

PARS2

PARS2 Human Purified
  Abnova Taiwan Corp.

Positive controls for PARS2 (1 products)

Catalog No. Species Pres. Purity   Source  

PARS2 overexpression lysate

PARS2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn