TA334450 GTPBP4 antibody

Rabbit Polyclonal Anti-GTPBP4 Antibody

See related secondary antibodies

Search for all "GTPBP4"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Rabbit, Rat GTPBP4

Product Description for GTPBP4

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Rabbit, Rat GTPBP4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for GTPBP4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CRFG, Chronic renal failure gene protein, GTP-binding protein NGB, NOG1, Nucleolar GTP-binding protein 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BZE4
Immunogen:
The immunogen for anti-GTPBP4 antibody: synthetic peptide directed towards the C terminal of human GTPBP4. Synthetic peptide located within the following region: MVKKAKTMMKNAQKKMNRLGKKGEADRHVFDMKPKHLLSGKRKAGKKDRR.
GeneID:
23560
Application WB
Background GTP-binding proteins are GTPases and function as molecular switches that can flip between two states: active, when GTP is bound, and ictive, when GDP is bound. 'Active' in this context usually means that the molecule acts as a sigl to trigger other events in the cell. When an extracellular ligand binds to a G-protein-linked receptor, the receptor changes its conformation and switches on the trimeric G proteins that associate with it by causing them to eject their GDP and replace it with GTP. The switch is turned off when the G protein hydrolyzes its own bound GTP, converting it back to GDP. But before that occurs, the active protein has an opportunity to diffuse away from the receptor and deliver its message for a prolonged period to its downstream target.GTP-binding proteins are GTPases and function as molecular switches that can flip between two states: active, when GTP is bound, and ictive, when GDP is bound. 'Active' in this context usually means that the molecule acts as a sigl to trigger other events in the cell. When an extracellular ligand binds to a G-protein-linked receptor, the receptor changes its conformation and switches on the trimeric G proteins that associate with it by causing them to eject their GDP and replace it with GTP. The switch is turned off when the G protein hydrolyzes its own bound GTP, converting it back to GDP. But before that occurs, the active protein has an opportunity to diffuse away from the receptor and deliver its message for a prolonged period to its downstream target.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for GTPBP4 (2 products)

Catalog No. Species Pres. Purity   Source  

GTPBP4

GTPBP4 Human Purified
  Abnova Taiwan Corp.

GTPBP4

GTPBP4 Human Purified
  Abnova Taiwan Corp.

Positive controls for GTPBP4 (2 products)

Catalog No. Species Pres. Purity   Source  

GTPBP4 293T Cell Transient Overexpression Lysate(Denatured)

GTPBP4 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

GTPBP4 Lysate

Western Blot: GTPBP4 Lysate [NBL1-11401] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for GTPBP4
  Novus Biologicals Inc.
  • LinkedIn