TA334483 Cytohesin 4 antibody

Rabbit Polyclonal Anti-CYTH4 Antibody

See related secondary antibodies

Search for all "Cytohesin 4"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat Cytohesin 4

Product Description for Cytohesin 4

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat Cytohesin 4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Cytohesin 4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CYT4, CYTH4, PSCD4
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UIA0
Immunogen:
The immunogen for anti-CYTH4 antibody: synthetic peptide directed towards the N terminal of human CYTH4. Synthetic peptide located within the following region: NKTAIGTYLGERDPINLQVLQAFVDCHEFANLNLVQALRQFLWSFRLPGE.
GeneID:
27128
Application WB
Background CYTH4 promotes guanine-nucleotide exchange on ARF1 and ARF5. CYTH4 promotes the activation of ARF through replacement of GDP with GTP.Pleckstrin homology, Sec7 and coiled/coil domains 4 (CYTH4) is a member of the PSCD family. Members of this family have identical structural organization that consists of an N-termil coiled-coil motif, a central Sec7 domain, and a C-termil pleckstrin homology (PH) domain. The coiled-coil motif is involved in homodimerization, the Sec7 domain contains guanine-nucleotide exchange protein (GEP) activity, and the PH domain interacts with phospholipids and is responsible for association of PSCDs with membranes. Members of this family appear to mediate the regulation of protein sorting and membrane trafficking. The CYTH4 exhibits GEP activity in vitro with both ARF1 and ARF5 but is ictive with ARF6. The CYTH4 and PSCD1 gene structures are very similar.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Cytohesin 4 (5 products)

Catalog No. Species Pres. Purity   Source  

Cytohesin 4

Cytohesin 4 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Cytohesin 4

Cytohesin 4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Cytohesin 4

Cytohesin 4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Cytohesin 4

Cytohesin 4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Cytohesin 4

Cytohesin 4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Cytohesin 4 (3 products)

Catalog No. Species Pres. Purity   Source  

CYTH4 overexpression lysate

CYTH4 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

PSCD4 293T Cell Transient Overexpression Lysate(Denatured)

PSCD4 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

PSCD4 Lysate

Western Blot: PSCD4 Lysate [NBL1-14858] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for CYTH4.
  Novus Biologicals Inc.
  • LinkedIn