TA334484 Isoleucyl-tRNA synthetase / IARS antibody

Rabbit Polyclonal Anti-IARS Antibody

See related secondary antibodies

Search for all "Isoleucyl-tRNA synthetase / IARS"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Porcine, Rabbit, Yeast Isoleucyl-tRNA synthetase / IARS

Product Description for Isoleucyl-tRNA synthetase / IARS

Rabbit anti Bovine, Canine, Guinea Pig, Human, Porcine, Rabbit, Yeast Isoleucyl-tRNA synthetase / IARS.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Isoleucyl-tRNA synthetase / IARS

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms IRS, IleRS, cytoplasmatic Isoleucine-tRNA ligase
Presentation Purified
Reactivity Bov, Can, GP, Hu, Por, Rb, Ye
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P41252
Immunogen:
The immunogen for anti-IARS antibody: synthetic peptide directed towards the N terminal of human IARS. Synthetic peptide located within the following region: SKHKPKFTFYDGPPFATGLPHYGHILAGTIKDIVTRYAHQSGFHVDRRFG.
GeneID:
3376
Application WB
Background Aminoacyl-tR synthetases catalyze the aminoacylation of tR by their cogte amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRS, aminoacyl-tR synthetases are thought to be among the first proteins that appeared in evolution. Isoleucine-tR synthetase belongs to the class-I aminoacyl-tR synthetase family and has been identified as a target of autoantibodies in the autoimmune disease polymyositis/dermatomyositis. Altertively spliced transcript variants have been found. [provided by RefSeq, Nov 2012].
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Isoleucyl-tRNA synthetase / IARS (2 products)

Catalog No. Species Pres. Purity   Source  

Isoleucyl-tRNA synthetase / IARS

Isoleucyl-tRNA synthetase / IARS Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Isoleucyl-tRNA synthetase / IARS

Isoleucyl-tRNA synthetase / IARS Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for Isoleucyl-tRNA synthetase / IARS (2 products)

Catalog No. Species Pres. Purity   Source  

IARS 293T Cell Transient Overexpression Lysate(Denatured)

IARS 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

IARS overexpression lysate

IARS overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn