TA334490 REM1 antibody

Rabbit Polyclonal Anti-REM1 Antibody

See related secondary antibodies

Search for all "REM1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Guinea Pig, Mouse, Porcine, Rabbit, Sheep REM1

Product Description for REM1

Rabbit anti Canine, Equine, Guinea Pig, Mouse, Porcine, Rabbit, Sheep REM1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for REM1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms GES, GTP-binding protein REM 1, GTPase-regulating endothelial cell sprouting, REM, Rad and Gem-like GTP-binding protein 1
Presentation Purified
Reactivity Can, Eq, GP, Ms, Por, Rb, Sh
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O75628
Immunogen:
The immunogen for anti-REM1 antibody: synthetic peptide directed towards the N terminal of human REM1. Synthetic peptide located within the following region: SDSEGSWEALYRVVLLGDPGVGKTSLASLFAGKQERDLHEQLGEDVYERT.
GeneID:
28954
Application WB
Background The protein encoded by this gene is a GTPase and member of the RAS-like GTP-binding protein family. The encoded protein is expressed in endothelial cells, where it promotes reorganization of the actin cytoskeleton and morphological changes in the cells.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for REM1 (5 products)

Catalog No. Species Pres. Purity   Source  

REM1

REM1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

REM1

REM1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

REM1

REM1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

REM1

REM1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

REM1

REM1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for REM1 (2 products)

Catalog No. Species Pres. Purity   Source  

REM1 293T Cell Transient Overexpression Lysate(Denatured)

REM1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

REM1 overexpression lysate

REM1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn