TA334496 METTL5 antibody

Rabbit Polyclonal Anti-METTL5 Antibody

See related secondary antibodies

Search for all "METTL5"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat METTL5

Product Description for METTL5

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rat METTL5.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for METTL5

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms DC3, HSPC133, Methyltransferase-like protein 5
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NRN9
Immunogen:
The immunogen for anti-METTL5 antibody: synthetic peptide directed towards the N terminal of human METTL5. Synthetic peptide located within the following region: KKVRLKELESRLQQVDGFEKPKLLLEQYPTRPHIAACMLYTIHNTYDDIE.
GeneID:
29081
Application WB
Background METTL5 is a probable methyltransferase.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for METTL5 (2 products)

Catalog No. Species Pres. Purity   Source  

METTL5

METTL5 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

METTL5

METTL5 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for METTL5 (1 products)

Catalog No. Species Pres. Purity   Source  

METTL5 293T Cell Transient Overexpression Lysate(Denatured)

METTL5 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn