TA334510 TGDS antibody

Rabbit Polyclonal Anti-TGDS Antibody

See related secondary antibodies

Search for all "TGDS"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Porcine, Rabbit, Rat TGDS

Product Description for TGDS

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Porcine, Rabbit, Rat TGDS.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TGDS

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 6-dehydratase, dTDP-D-glucose 4
Presentation Purified
Reactivity Bov, Can, Eq, GP, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O95455
Immunogen:
The immunogen for anti-TGDS antibody: synthetic peptide directed towards the middle region of human TGDS. Synthetic peptide located within the following region: DEVYGGSLDKEFDESSPKQPTNPYASSKAAAECFVQSYWEQYKFPVVITR.
GeneID:
23483
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TGDS (2 products)

Catalog No. Species Pres. Purity   Source  

TGDS

TGDS Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TGDS

TGDS Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for TGDS (3 products)

Catalog No. Species Pres. Purity   Source  

TGDS 293T Cell Transient Overexpression Lysate(Denatured)

TGDS 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

TGDS 293T Cell Transient Overexpression Lysate(Denatured)

TGDS 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

TGDS Lysate

Western Blot: TGDS Lysate [NBL1-16850] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for TGDS
  Novus Biologicals Inc.
  • LinkedIn