TA334512 KLHDC2 antibody

Rabbit Polyclonal Anti-KLHDC2 Antibody

See related secondary antibodies

Search for all "KLHDC2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Guinea Pig, Human, Porcine, Rabbit, Rat KLHDC2

Product Description for KLHDC2

Rabbit anti Canine, Equine, Guinea Pig, Human, Porcine, Rabbit, Rat KLHDC2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for KLHDC2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms HCA33, HCLP-1, Hepatocellular carcinoma-associated antigen 33, Host cell factor homolog LCP, Host cell factor-like protein 1, Kelch domain-containing protein 2
Presentation Purified
Reactivity Can, Eq, GP, Hu, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y2U9
Immunogen:
The immunogen for anti-KLHDC2 antibody: synthetic peptide directed towards the N terminal of human KLHDC2. Synthetic peptide located within the following region: VSDGRHMFVWGGYKSNQVRGLYDFYLPREELWIYNMETGRWKKINTEGDV.
GeneID:
23588
Application WB
Background KLHDC2 represses CREB3-mediated transcription by interfering with CREB3-D binding. It contains 6 Kelch repeats.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for KLHDC2 (3 products)

Catalog No. Species Pres. Purity   Source  

KLHDC2

KLHDC2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

KLHDC2

KLHDC2 Human Purified
  Abnova Taiwan Corp.

KLHDC2

KLHDC2 Human Purified
  Abnova Taiwan Corp.

Positive controls for KLHDC2 (2 products)

Catalog No. Species Pres. Purity   Source  

KLHDC2 Lysate

Western Blot: KLHDC2 Lysate [NBL1-12325] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for KLHDC2
  Novus Biologicals Inc.

KLHDC2 overexpression lysate

KLHDC2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn