HSPB8 / HSP22 - TA334525 | acris-antibodies.com

Product Description for HSPB8 / HSP22

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat HSPB8 / HSP22.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for HSPB8 / HSP22

Product Category	Primary Antibodies
Quantity	0.1 ml
Synonyms	Alpha-crystallin C chain, CRYAC, E2-induced gene 1 protein, E2IG1, Heat shock protein beta-8, Protein kinase H11, Small stress protein-like protein HSP22
Presentation	Purified
Reactivity	Bov, Eq, GP, Hu, Ms, Por, Rt
Applications	WB
Clonality	Polyclonal
Host	Rabbit
Isotype	IgG
Shipping to	Europe, USA/Canada
PDF datasheet	View Datasheet
Manufacturer	OriGene Technologies, Inc.

Datasheet Extract

Immunogen	Swiss Prot Num: Q9UJY1 Immunogen: The immunogen for anti-HSPB8 antibody: synthetic peptide directed towards the N terminal of human HSPB8. Synthetic peptide located within the following region: ADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDW. GeneID: 26353
Application	WB
Background	HSPB8 belongs to the superfamily of small heat-shock proteins containing a conservative alpha-crystallin domain at the C-termil part of the molecule. The expression of HSPB8 protein is induced by estrogen in estrogen receptor-positive breast cancer cells, and this protein also functions as a chaperone in association with Bag3, a stimulator of macroautophagy. Thus, HSPB8 appears to be involved in regulation of cell proliferation, apoptosis, and carcinogenesis, and mutations in the encoding HSPB8 gene have been associated with different neuromuscular diseases, including Charcot-Marie-Tooth disease. The protein encoded by this gene belongs to the superfamily of small heat-shock proteins containing a conservative alpha-crystallin domain at the C-termil part of the molecule. The expression of this gene in induced by estrogen in estrogen receptor-positive breast cancer cells, and this protein also functions as a chaperone in association with Bag3, a stimulator of macroautophagy. Thus, this gene appears to be involved in regulation of cell proliferation, apoptosis, and carcinogenesis, and mutations in this gene have been associated with different neuromuscular diseases, including Charcot-Marie-Tooth disease. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications.
Format	Purification: Affinity Purified Buffer System: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. State: Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for HSPB8 / HSP22 (16 products)

Catalog No.	Species	Pres.	Purity	Source
TP301040	HSPB8 / HSP22
	Human		> 80 % Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps. Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.	HEK293 cells	20 µg / €748.00
					OriGene Technologies, Inc.
AR09392PU-L	HSPB8 / HSP22 (1-196, His-tag)
	Human	Purified	> 95 % by SDS - PAGE	E. coli	0.25 mg / €1,070.00
					OriGene Technologies GmbH
AR09392PU-N	HSPB8 / HSP22 (1-196, His-tag)
	Human	Purified	> 95 % by SDS - PAGE	E. coli	50 µg / €400.00
					OriGene Technologies GmbH
AR10342PU-L	HSPB8 / HSP22
	Human	Purified	> 95.0% as determined by SDS-PAGE. Immunological Activity: Confirmed by reaction with monoclonal Mouse antibodies against HSP22.	E. coli
					OriGene Technologies GmbH
AR10342PU-N	HSPB8 / HSP22
	Human	Purified	> 95.0% as determined by SDS-PAGE. Immunological Activity: Confirmed by reaction with monoclonal Mouse antibodies against HSP22.	E. coli
					OriGene Technologies GmbH
AR10342PU-S	HSPB8 / HSP22
	Human	Purified	> 95.0% as determined by SDS-PAGE. Immunological Activity: Confirmed by reaction with monoclonal Mouse antibodies against HSP22.	E. coli
					OriGene Technologies GmbH
H00026353-P01-10	HSPB8 / HSP22
	Human		12.5% SDS-PAGE Stained with Coomassie Blue.	in vitro transl.
					Abnova Taiwan Corp.
H00026353-P01-25	HSPB8 / HSP22
	Human		12.5% SDS-PAGE Stained with Coomassie Blue.	in vitro transl.
					Abnova Taiwan Corp.
H00026353-Q01-10	HSPB8 / HSP22
	Human		12.5% SDS-PAGE Stained with Coomassie Blue.	in vitro transl.
					Abnova Taiwan Corp.
H00026353-Q01-25	HSPB8 / HSP22
	Human		12.5% SDS-PAGE Stained with Coomassie Blue.	in vitro transl.
					Abnova Taiwan Corp.
H00026353-Q02	HSPB8 / HSP22
	Human	Purified
					Abnova Taiwan Corp.
H00026353-Q02-10	HSPB8 / HSP22
	Human		12.5% SDS-PAGE Stained with Coomassie Blue.	in vitro transl.
					Abnova Taiwan Corp.
H00026353-Q02-25	HSPB8 / HSP22
	Human		12.5% SDS-PAGE Stained with Coomassie Blue.	in vitro transl.
					Abnova Taiwan Corp.
P4145	HSPB8 / HSP22
	Human
					Abnova Taiwan Corp.
8HSP22	HSPB8 / HSP22
	Human	Purified	> 95 %	E. coli
					HyTest Ltd.
NBP1-41159	HSPB8 / HSP22

					Novus Biologicals Inc.

Positive controls for HSPB8 / HSP22 (3 products)

Catalog No.	Species
NBL1-11761	HSP22 Lysate

		Novus Biologicals Inc.
H00026353-T01	HSPB8 293T Cell Transient Overexpression Lysate(Denatured)

		Abnova Taiwan Corp.
LY415329	HSPB8 overexpression lysate
		0.1 mg / €295.00
		OriGene Technologies, Inc.

Recommended Secondary Antibodies for HSPB8 / HSP22 (9 products)

Catalog No.	Host	Pres.	React.	Applications
R1364AP	Rabbit IgG (H+L chain) antibody
	Goat	AP	Rb	E, WB
					OriGene Technologies GmbH
R1364B	Rabbit IgG (H+L chain) antibody
	Goat	Biotin	Rb	E, WB
					OriGene Technologies GmbH
R1364F	Rabbit IgG (H+L chain) antibody
	Goat	FITC	Rb	E, ICC/IF, WB
					OriGene Technologies GmbH
R1364HRP	Rabbit IgG (H+L chain) antibody
	Goat	HRP	Rb	E, P, WB
					OriGene Technologies GmbH
R1364T	Rabbit IgG (H+L chain) antibody
	Goat	TRITC	Rb	E, F, ICC/IF
					OriGene Technologies GmbH
R1427R	Rabbit IgG F(ab)2 Fragment (H+L chain) antibody
	Donkey	PE	Rb	F
					OriGene Technologies GmbH
R1458C2	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy2
					OriGene Technologies GmbH
R1458C3	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy3
					OriGene Technologies GmbH
R1458C5	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy5
					OriGene Technologies GmbH