TA334538 Sestrin-1 (SESN1) antibody

Rabbit Polyclonal Anti-SESN1 Antibody

See related secondary antibodies

Search for all "Sestrin-1 (SESN1)"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rat Sestrin-1 (SESN1)

Product Description for Sestrin-1 (SESN1)

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rat Sestrin-1 (SESN1).
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Sestrin-1 (SESN1)

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms PA26, SEST1, Sestrin 1
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y6P5
Immunogen:
The immunogen for anti-SESN1 antibody is: synthetic peptide directed towards the middle region of Human SESN1. Synthetic peptide located within the following region: KWLNGLENAPQKLQNLGELNKVLAHRPWLITKEHIEGLLKAEEHSWSLAE.
GeneID:
27244
Application WB
Background This gene encodes a member of the sestrin family. Sestrins are induced by the p53 tumor suppressor protein and play a role in the cellular response to D damage and oxidative stress. The encoded protein mediates p53 inhibition of cell growth by activating AMP-activated protein kise, which results in the inhibition of the mammalian target of rapamycin protein. The encoded protein also plays a critical role in antioxidant defense by regenerating overoxidized peroxiredoxins, and the expression of this gene is a potential marker for exposure to radiation. Altertively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Sestrin-1 (SESN1) (3 products)

Catalog No. Species Pres. Purity   Source  

Sestrin-1 (SESN1)

Sestrin-1 (SESN1) Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Sestrin-1 (SESN1)

Sestrin-1 (SESN1) Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Sestrin-1 (SESN1)

Western Blot: SESN1 Protein [NBP1-44997] - WB of SESN1 at 1:500 dilution in diluObuffer
was probed with PCSESN1 sample. Apparent MW of SESN1 is 89kDa Human Aff - Purified
  Novus Biologicals Inc.

Positive controls for Sestrin-1 (SESN1) (1 products)

Catalog No. Species Pres. Purity   Source  

SESN1 293T Cell Transient Overexpression Lysate(Denatured)

SESN1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn