TA334552 SENP1 antibody

Rabbit Polyclonal Anti-SENP1 Antibody

See related secondary antibodies

Search for all "SENP1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Porcine, Rabbit, Rat SENP1

Product Description for SENP1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Porcine, Rabbit, Rat SENP1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SENP1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Sentrin-specific protease 1, Sentrin/SUMO-specific protease SENP1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9P0U3-2
Immunogen:
The immunogen for anti-SENP1 antibody: synthetic peptide directed towards the middle region of human SENP1. Synthetic peptide located within the following region: PQQMNGSDCGMFACKYADCITKDRPINFTQQHMPYFRKRMVWEILHRKLL.
GeneID:
29843
Application WB
Background The covalent modification of proteins by the small ubiquitin-like protein SUMO is implicated in the regulation of nucleocytoplasmic transport, genomic stability, gene transcription, and other processes. Sumoylation is catalyzed on target lysine residues by a multienzyme process and is reversed by desumoylating enzymes such as SENP1.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SENP1 (2 products)

Catalog No. Species Pres. Purity   Source  

SENP1

SENP1 Human
  Abnova Taiwan Corp.

SENP1

SENP1 Human
  Abnova Taiwan Corp.
  • LinkedIn