TA334562 CPEB3 antibody

Rabbit Polyclonal Anti-CPEB3 Antibody

See related secondary antibodies

Search for all "CPEB3"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat CPEB3

TA334562

More Views

  • TA334562

Product Description for CPEB3

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat CPEB3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CPEB3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CPE-BP3, CPE-binding protein 3, Cytoplasmic polyadenylation element-binding protein 3, KIAA0940, hCPEB-3
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NE35
Immunogen:
The immunogen for anti-CPEB3 antibody: synthetic peptide directed towards the middle region of human CPEB3. Synthetic peptide located within the following region: RTDNGNNLLPFQDRSRPYDTFNLHSLENSLMDMIRTDHEPLKGKHYPPSG.
GeneID:
22849
Application WB
Background The exact function of CPEB3 remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CPEB3 (2 products)

Catalog No. Species Pres. Purity   Source  

CPEB3

CPEB3 Human Purified
  Abnova Taiwan Corp.

CPEB3

CPEB3 Human Purified
  Abnova Taiwan Corp.

Positive controls for CPEB3 (2 products)

Catalog No. Species Pres. Purity   Source  

CPEB3 293T Cell Transient Overexpression Lysate(Denatured)

CPEB3 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

CPEB3 Lysate

Western Blot: CPEB3 Lysate [NBL1-09433] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for CPEB3
  Novus Biologicals Inc.
  • LinkedIn