TA334563 R3HDM2 antibody

Rabbit Polyclonal Anti-R3HDM2 Antibody

See related secondary antibodies

Search for all "R3HDM2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat R3HDM2

Product Description for R3HDM2

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat R3HDM2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for R3HDM2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KIAA1002, R3H domain-containing protein 2
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y2K5
Immunogen:
The immunogen for anti-R3HDM2 antibody: synthetic peptide directed towards the middle region of human R3HDM2. Synthetic peptide located within the following region: QSTYTVHQGQSGLKHGNRGKRQALKSASTDLGTADVVLGRVLEVTDLPEG.
GeneID:
22864
Application WB
Background R3HDM2 contains 1 R3H domain. The function of R3HDM2 remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for R3HDM2 (2 products)

Catalog No. Species Pres. Purity   Source  

R3HDM2 293T Cell Transient Overexpression Lysate(Denatured)

R3HDM2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

R3HDM2 overexpression lysate

R3HDM2 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn