TA334564 FASTKD2 antibody

Rabbit Polyclonal Anti-FASTKD2 Antibody

See related secondary antibodies

Search for all "FASTKD2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Equine, Human FASTKD2

Product Description for FASTKD2

Rabbit anti Equine, Human FASTKD2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FASTKD2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms FAST kinase domain-containing protein 2, FASTKD2, KIAA0971
Presentation Purified
Reactivity Eq, Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NYY8
Immunogen:
The immunogen for anti-FASTKD2 antibody: synthetic peptide directed towards the middle region of human FASTKD2. Synthetic peptide located within the following region: DTNRNQVLPLSDVDTTSATDIQRVAVLCVSRSAYCLGSSHPRGFLAMKMR.
GeneID:
22868
Application WB
Background This gene encodes a protein that is localized in the mitochondrial inner compartment and that may play a role in mitochondrial apoptosis. Nonsense mutations have been reported to result in cytochrome c oxidase deficiency.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for FASTKD2 (2 products)

Catalog No. Species Pres. Purity   Source  

FASTKD2

FASTKD2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

FASTKD2

FASTKD2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn