TA334616 SLC35F3 antibody

Rabbit Polyclonal Anti-Slc35f3 Antibody

See related secondary antibodies

Search for all "SLC35F3"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Porcine, Rabbit, Rat SLC35F3

Product Description for SLC35F3

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Porcine, Rabbit, Rat SLC35F3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SLC35F3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Solute carrier family 35 member F3
Presentation Purified
Reactivity Bov, Can, Eq, GP, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IY50-2
Immunogen:
The immunogen for anti-Slc35f3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IGLGFLLLLLPEEWDVWLIKLLTRLKVRKKEETAESSGDLGTGPQSRSRR.
GeneID:
148641
Application WB
Background Slc35f3 is a putative solute transporter Potential.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn