TA334660 SGCB (Beta-sarcoglycan) antibody

Rabbit Polyclonal Anti-SGCB Antibody

See related secondary antibodies

Search for all "SGCB (Beta-sarcoglycan)"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rat SGCB (Beta-sarcoglycan)

Product Description for SGCB (Beta-sarcoglycan)

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rat SGCB (Beta-sarcoglycan).
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SGCB (Beta-sarcoglycan)

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 43 kDa dystrophin-associated glycoprotein, 43DAG, A3b, Beta sarcoglycan, Beta-SG
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q16585
Immunogen:
The immunogen for anti-SGCB antibody is: synthetic peptide directed towards the middle region of Human SGCB. Synthetic peptide located within the following region: RIGPNGCDSMELHESGLLRFKQVSDMGVIHPLYKSTVGGRRNENLVITGN.
GeneID:
6443
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SGCB (Beta-sarcoglycan) (7 products)

Catalog No. Species Pres. Purity   Source  

SGCB (Beta-sarcoglycan)

SGCB (Beta-sarcoglycan) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

SGCB (Beta-sarcoglycan) (87-318, His-tag)

SGCB (Beta-sarcoglycan) Human Purified > 90 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

SGCB (Beta-sarcoglycan) (87-318, His-tag)

SGCB (Beta-sarcoglycan) Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

SGCB (Beta-sarcoglycan)

SGCB (Beta-sarcoglycan) Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

SGCB (Beta-sarcoglycan)

SGCB (Beta-sarcoglycan) Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

SGCB (Beta-sarcoglycan)

SGCB (Beta-sarcoglycan) Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

SGCB (Beta-sarcoglycan)

SGCB (Beta-sarcoglycan) Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for SGCB (Beta-sarcoglycan) (1 products)

Catalog No. Species Pres. Purity   Source  

beta Sarcoglycan Lysate

Western Blot: beta Sarcoglycan Lysate [NBL1-15903] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for SGCB
  Novus Biologicals Inc.
  • LinkedIn