TA334691 KIF23 antibody

Rabbit Polyclonal Anti-KIF23 Antibody

See related secondary antibodies

Search for all "KIF23"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse, Rabbit, Rat, Zebrafish KIF23

Product Description for KIF23

Rabbit anti Bovine, Canine, Human, Mouse, Rabbit, Rat, Zebrafish KIF23.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for KIF23

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KNSL5, Kinesin-like protein 5, Kinesin-like protein KIF23, MKLP1, Mitotic kinesin-like protein 1
Presentation Purified
Reactivity Bov, Can, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q02241
Immunogen:
The immunogen for anti-KIF23 antibody: synthetic peptide directed towards the middle region of human KIF23. Synthetic peptide located within the following region: KDEKLKQLKAIVTEPKTEKPERPSRERDREKVTQRSVSPSPVPLLFQPDQ.
GeneID:
9493
Application WB
Background KIF23 is a member of kinesin-like protein family. This family includes microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. This protein has been shown to cross-bridge antiparallel microtubules and drive microtubule movement in vitro. Alterte splicing of this gene results in two transcript variants encoding two different isoforms. The protein encoded by this gene is a member of kinesin-like protein family. This family includes microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. This protein has been shown to cross-bridge antiparallel microtubules and drive microtubule movement in vitro. Alterte splicing of this gene results in two transcript variants encoding two different isoforms.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for KIF23 (1 products)

Catalog No. Species Pres. Purity   Source  

KIF23 Lysate(Denatured)

KIF23 Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn