TA334715 FABP4 antibody

Rabbit Polyclonal Anti-FABP4 Antibody

See related secondary antibodies

Search for all "FABP4"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Goat, Human, Rabbit, Sheep FABP4

TA334715

More Views

  • TA334715

Product Description for FABP4

Rabbit anti Bovine, Canine, Equine, Goat, Human, Rabbit, Sheep FABP4.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for FABP4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms A-FABP, Adipocyte lipid-binding protein, Fatty acid-binding protein 4
Presentation Purified
Reactivity Bov, Can, Eq, Gt, Hu, Rb, Sh
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P15090
Immunogen:
The immunogen for anti-FABP4 antibody: synthetic peptide directed towards the middle region of human FABP4. Synthetic peptide located within the following region: FDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVM.
GeneID:
2167
Application WB
IHC
Background FABP4 encodes the fatty acid binding protein found in adipocytes. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism.FABP4 encodes the fatty acid binding protein found in adipocytes. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for FABP4 (8 products)

Catalog No. Species Pres. Purity   Source  

FABP4

FABP4 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

FABP4

FABP4 Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
10 µg / €299.00
  OriGene Technologies, Inc.

FABP4 (1-132)

FABP4 Human Purified > 95 % > 95% by SDS-PAGE E. coli
0.5 mg / €1,070.00
  OriGene Technologies GmbH

FABP4 (1-132)

FABP4 Human Purified > 95 % > 95% by SDS-PAGE E. coli
0.1 mg / €400.00
  OriGene Technologies GmbH

FABP4

12% SDS-PAGE separation of Human A FABP
1. M.W. marker - 14, 21, 31, 45, 66, 97 kDa
2. reduced and heated sample, 5µg/lane
3. non-reduced and non-heated sample, 5µg/lane Human Purified > 90 % >90% E. coli
0.1 mg / €490.00
  OriGene Technologies GmbH

FABP4

FABP4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

FABP4

FABP4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

FABP4

SDS-Page: FABP4 Protein [NBC1-18492] - FABP4, 14kDa (132aa), confirmed by MALDI-TOF with a purity of 95% by SDS - PAGE Protein
  Novus Biologicals Inc.

Positive controls for FABP4 (2 products)

Catalog No. Species Pres. Purity   Source  

FABP4 293T Cell Transient Overexpression Lysate(Denatured)

FABP4 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

FABP4 Lysate

Western Blot: FABP4 Lysate [NBL1-10420] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for FABP4
  Novus Biologicals Inc.
  • LinkedIn