TA334732 RGS13 antibody

Rabbit Polyclonal Anti-RGS13 Antibody

See related secondary antibodies

Search for all "RGS13"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat RGS13

TA334732

More Views

  • TA334732

Product Description for RGS13

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat RGS13.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for RGS13

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Regulator of G-protein signaling 13
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Rb, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O14921
Immunogen:
The immunogen for anti-RGS13 antibody: synthetic peptide directed towards the middle region of human RGS13. Synthetic peptide located within the following region: WSRISRAKKLYKIYIQPQSPREINIDSSTRETIIRNIQEPTETCFEEAQK.
GeneID:
6003
Application WB
IHC
Background RGS13 encodes a protein which is a member of the regulator of G protein sigling (RGS) family. RGS proteins accelerate GTPase activity of G protein alpha-subunits, thereby driving G protein into their ictive GDP-bound form, thus negatively regulating G protein sigling. RGS proteins have been implicated in the fine tuning of a variety of cellular events in response to G protein-coupled receptor activation.
Format
Purification:
Protein A purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for RGS13 (7 products)

Catalog No. Species Pres. Purity   Source  

RGS13 (transcript variant 2)

RGS13 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

RGS13

RGS13 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RGS13

RGS13 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RGS13

RGS13 Human Purified
  Abnova Taiwan Corp.

RGS13

RGS13 Human Purified
  Abnova Taiwan Corp.

RGS13

RGS13 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RGS13

RGS13 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for RGS13 (2 products)

Catalog No. Species Pres. Purity   Source  

RGS13 Lysate(Denatured)

RGS13 Lysate(Denatured)
  Abnova Taiwan Corp.

RGS13 Lysate

Western Blot: RGS13 Lysate [NBL1-15320] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for RGS13.
  Novus Biologicals Inc.
  • LinkedIn