TA334738 VPS72 antibody

Rabbit Polyclonal Anti-TCFL1 Antibody

See related secondary antibodies

Search for all "VPS72"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse, Rabbit, Rat, Zebrafish, African clawed frog VPS72

Product Description for VPS72

Rabbit anti Bovine, Canine, Human, Mouse, Rabbit, Rat, Zebrafish, African clawed frog VPS72.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for VPS72

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms TCFL1, Vacuolar protein sorting-associated protein 72 homolog, YL1
Presentation Aff - Purified
Reactivity African clawed frog, Bov, Can, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q15906
Immunogen:
The immunogen for anti-TCFL1 antibody: synthetic peptide directed towards the middle region of human TCFL1
AA Sequence:
TEELNLRSLETYERLEADKKKQVHKKRKCPGPIITYHSVTVPLVGEPGPK
GeneID:
6944
Application

Western blotting (0.05 - 0.5 µg/ml)

Background TCFL1 or VPS72 encodes the YL-1 protein which is a subunit of the TRRAP/TIP60 HAT complex, and also is a component of a novel mammalian multiprotein complex that includes the SNF2-related helicase SRCAP. It could act as a DNA-binding transcriptional regulator and may be involved in chromatin modification and remodeling.
General Readings Horikawa,I., et al., (1995) Oshimura,M. Biochem. Biophys. Res. Commun. 208 (3), 999-1007
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Mouse, Rat, Dog, Bovine, Rabbit, Zebrafish, African clawed frog
Species reactivity (tested):
Human

Accessory Products

Proteins and/or Positive Controls

Proteins for VPS72 (3 products)

Catalog No. Species Pres. Purity   Source  

VPS72

VPS72 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

VPS72

VPS72 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

VPS72

VPS72 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for VPS72 (3 products)

Catalog No. Species Pres. Purity   Source  

VPS72 293T Cell Transient Overexpression Lysate(Denatured)

VPS72 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

VPS72 overexpression lysate

VPS72 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

YL1 Lysate

Western Blot: YL1 Lysate [NBL1-17758] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for VPS72
  Novus Biologicals Inc.
  • LinkedIn