TA334742 KIF2B antibody

Rabbit Polyclonal Anti-KIF2B Antibody

See related secondary antibodies

Search for all "KIF2B"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Rabbit KIF2B

Product Description for KIF2B

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Rabbit KIF2B.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for KIF2B

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Kinesin-like protein KIF2B
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Rb
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N4N8
Immunogen:
The immunogen for anti-KIF2B antibody: synthetic peptide directed towards the middle region of human KIF2B. Synthetic peptide located within the following region: DCSKGIYALVAQDVFLLLRNSTYEKLDLKVYGTFFEIYGGKVYDLLNWKK.
GeneID:
84643
Application WB
Background KIF2B is the plus end-directed microtubule-dependent motor required for spindle assembly and chromosome movement. KIF2B has microtubule depolymerization activity.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for KIF2B (1 products)

Catalog No. Species Pres. Purity   Source  

KIF2B overexpression lysate

KIF2B overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn