TA334752 PPAR-alpha antibody

Rabbit Polyclonal Anti-PPARA Antibody

See related secondary antibodies

Search for all "PPAR-alpha"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Goat, Human, Mouse, Porcine, Rat, Sheep PPAR-alpha

Product Description for PPAR-alpha

Rabbit anti Bovine, Equine, Goat, Human, Mouse, Porcine, Rat, Sheep PPAR-alpha.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PPAR-alpha

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms NR1C1, Nuclear receptor subfamily 1 group C member 1, PPAR, PPARA, Peroxisome proliferator-activated receptor alpha
Presentation Purified
Reactivity Bov, Eq, Gt, Hu, Ms, Por, Rt, Sh
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q07869
Immunogen:
The immunogen for anti-PPARA antibody: synthetic peptide directed towards the middle region of human PPARA. Synthetic peptide located within the following region: SEKAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVI.
GeneID:
5465
Application WB
Background Peroxisome proliferators include hypolipidemic drugs, herbicides, leukotriene antagonists, and plasticizers; this term arises because they induce an increase in the size and number of peroxisomes. Peroxisomes are subcellular organelles found in plants and and animals that contain enzymes for respiration and for cholesterol and lipid metabolism. The action of peroxisome proliferators is thought to be mediated via specific receptors, called PPARs, which belong to the steroid hormone receptor superfamily. PPARs affect the expression of target genes involved in cell proliferation, cell differentiation and in immune and inflammation responses. Three closely related subtypes (alpha, beta/delta, and gamma) have been identified. This gene encodes the subtype PPAR-alpha, which is a nuclear transcription factor. Multiple altertively spliced transcript variants have been described for this gene, although the full-length ture of only two has been determined. [provided by RefSeq, Jul 2008]
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PPAR-alpha (2 products)

Catalog No. Species Pres. Purity   Source  

PPAR-alpha

PPAR-alpha Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PPAR-alpha

PPAR-alpha Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for PPAR-alpha (2 products)

Catalog No. Species Pres. Purity   Source  

PPARA 293T Cell Transient Overexpression Lysate(Denatured)

PPARA 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

PPAR alpha Lysate

Western Blot: PPAR alpha Lysate [NBL1-14631] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PPARA
  Novus Biologicals Inc.
  • LinkedIn