TA334767 TRIM13 / RNF77 antibody

Rabbit Polyclonal Anti-RFP2 Antibody

See related secondary antibodies

Search for all "TRIM13 / RNF77"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Human, Mouse, Rat TRIM13 / RNF77

TA334767

More Views

  • TA334767
  • TA334767
  • TA334767

Product Description for TRIM13 / RNF77

Rabbit anti Bovine, Human, Mouse, Rat TRIM13 / RNF77.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for TRIM13 / RNF77

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms B-cell chronic lymphocytic leukemia tumor suppressor Leu5, LEU5, Leukemia-associated protein 5, Putative tumor suppressor RFP2, RFP2, RING finger protein 77, Tripartite motif-containing protein 13
Presentation Aff - Purified
Reactivity Bov, Hu, Ms, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O60858
Immunogen:
The immunogen for anti-TRIIM13 antibody: synthetic peptide directed towards the middle region of human TRIM13
AA Sequence:
DTLETSKRKSLQLLTKDSDKVKEFFEKLQHTLDQKKNEILSDFETMKLAV
GeneID:
10206
Application Western blotting (0.1 - 0.5 µg/ml)
Immunohistochemsitry on paraffin embedded sections (2 - 8 µg/ml)
Background TRIM13 is an E3 ubiquitin ligase involved in the retrotranslocation and turnover of membrane and secretory proteins from the ER through a set of processes named ER-associated degradation (ERAD). This process acts on misfolded proteins as well as in the regulated degradation of correctly folded proteins. TRIM13 enhances ionizing radiation-induced p53/TP53 stability and apoptosis via ubiquitinating MDM2 and AKT1 and decreasing AKT1 kinase activity through MDM2 and AKT1 proteasomal degradation, regulates ER stress-induced autophagy, and may act as a tumor suppressor.
General Readings "The RBCC gene RFP2 (Leu5) encodes a novel transmembrane E3 ubiquitin ligase involved in ERAD." Lerner M., Corcoran M., Cepeda D., Nielsen M.L., Zubarev R., Ponten F., Uhlen M., Hober S., Grander D., Sangfelt O. Mol. Biol. Cell 18:1670-1682(2007)
"Ret finger protein 2 enhances ionizing radiation-induced apoptosis via degradation of AKT and MDM2." Joo H.M., Kim J.Y., Jeong J.B., Seong K.M., Nam S.Y., Yang K.H., Kim C.S., Kim H.S., Jeong M., An S., Jin Y.W. Eur. J. Cell Biol. 90:420-431(2011)
"TRIM13 regulates ER stress induced autophagy and clonogenic ability of the cells." Tomar D., Singh R., Singh A.K., Pandya C.D., Singh R. Biochim. Biophys. Acta 1823:316-326(2012)
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Rat, Mouse, Bovine
Species reactivity (tested):
Human

Accessory Products

Proteins and/or Positive Controls

Proteins for TRIM13 / RNF77 (5 products)

Catalog No. Species Pres. Purity   Source  

TRIM13 / RNF77 (transcript variant 3)

TRIM13 / RNF77 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

TRIM13 / RNF77

TRIM13 / RNF77 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TRIM13 / RNF77

TRIM13 / RNF77 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TRIM13 / RNF77

TRIM13 / RNF77 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TRIM13 / RNF77

TRIM13 / RNF77 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for TRIM13 / RNF77 (1 products)

Catalog No. Species Pres. Purity   Source  

TRIM13 Lysate

Western Blot: TRIM13 Lysate [NBL1-17276] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for TRIM13
  Novus Biologicals Inc.
  • LinkedIn