TA334769 RNF13 / RZF antibody

Rabbit Polyclonal Anti-RNF13 Antibody

See related secondary antibodies

Search for all "RNF13 / RZF"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat RNF13 / RZF

TA334769

More Views

  • TA334769

Product Description for RNF13 / RZF

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat RNF13 / RZF.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RNF13 / RZF

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms E3 ubiquitin-protein ligase RNF13, RING finger protein 13
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O43567
Immunogen:
The immunogen for anti-RNF13 antibody: synthetic peptide directed towards the N terminal of human RNF13. Synthetic peptide located within the following region: ILAYNFENASQTFDDLPARFGYRLPAEGLKGFLINSKPENACEPIVPPPV.
GeneID:
11342
Application WB
Background RNF13 contains 1 RING-type zinc finger. The exact function of RNF13 is not known.The protein encoded by this gene contains a RING zinc finger, a motif known to be involved in protein-protein interactions. The specific function of this gene has not yet been determined. Altertively spliced transcript variants that encode the same protein have been reported. A pseudogene, which is also located on chromosome 3, has been defined for this gene.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for RNF13 / RZF (2 products)

Catalog No. Species Pres. Purity   Source  

RNF13 / RZF

RNF13 / RZF Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

RNF13 / RZF

RNF13 / RZF Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for RNF13 / RZF (5 products)

Catalog No. Species Pres. Purity   Source  

RNF13 Lysate

Western Blot: RNF13 Lysate [NBL1-15419] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for RNF13
  Novus Biologicals Inc.

RNF13 Lysate

Western Blot: RNF13 Lysate [NBL1-15420] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for RNF13
  Novus Biologicals Inc.

RNF13 overexpression lysate

RNF13 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

RNF13 overexpression lysate

RNF13 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

RNF13 overexpression lysate

RNF13 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn