TA334783 CCDC155 antibody

Rabbit Polyclonal Anti-CCDC155 Antibody

See related secondary antibodies

Search for all "CCDC155"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Human CCDC155

Product Description for CCDC155

Rabbit anti Bovine, Human CCDC155.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CCDC155

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Coiled-coil domain-containing protein 155
Presentation Purified
Reactivity Bov, Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N6L0
Immunogen:
The immunogen for anti-CCDC155 antibody is: synthetic peptide directed towards the C-terminal region of Human CCDC155. Synthetic peptide located within the following region: VIHETSEETEFPSEAPAGGQRNFQGEPAHPEEGRKEPSMWLTRREEEEDA.
GeneID:
147872
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CCDC155 (3 products)

Catalog No. Species Pres. Purity   Source  

CCDC155

CCDC155 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

CCDC155

CCDC155 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

CCDC155

CCDC155 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for CCDC155 (2 products)

Catalog No. Species Pres. Purity   Source  

CCDC155 overexpression lysate

CCDC155 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

FLJ32658 293T Cell Transient Overexpression Lysate(Denatured)

FLJ32658 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn