TA334787 C1orf210 / TEMP antibody

Rabbit Polyclonal Anti-C1orf210 Antibody

See related secondary antibodies

Search for all "C1orf210 / TEMP"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Human C1orf210 / TEMP

Product Description for C1orf210 / TEMP

Rabbit anti Bovine, Human C1orf210 / TEMP.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for C1orf210 / TEMP

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Type III endosome membrane protein TEMP
Presentation Purified
Reactivity Bov, Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IVY1
Immunogen:
The immunogen for anti-C1orf210 antibody is: synthetic peptide directed towards the middle region of Human C1orf210. Synthetic peptide located within the following region: VVLSLLIALAAKCHLCRRYHASYRHRPLPETGRGGRPQVAEDEDDDGFIE.
GeneID:
149466
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for C1orf210 / TEMP (3 products)

Catalog No. Species Pres. Purity   Source  

C1orf210 Lysate

C1orf210 Lysate Protein
  Novus Biologicals Inc.

C1orf210 overexpression lysate

C1orf210 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

C1orf210 overexpression lysate

C1orf210 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn