TA334794 C4orf45 antibody

Rabbit Polyclonal Anti-C4orf45 Antibody

See related secondary antibodies

Search for all "C4orf45"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Equine, Human C4orf45

Product Description for C4orf45

Rabbit anti Equine, Human C4orf45.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for C4orf45

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Purified
Reactivity Eq, Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96LM5
Immunogen:
The immunogen for anti-C4orf45 antibody is: synthetic peptide directed towards the C-terminal region of Human C4orf45. Synthetic peptide located within the following region: PWQPKPHVLDMQGKQSRASFAWHMSAFEDTDQRNSKWAILVRQCKSSLPR.
GeneID:
152940
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for C4orf45 (1 products)

Catalog No. Species Pres. Purity   Source  

C4orf45 overexpression lysate

C4orf45 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn